PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100088950061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HD-ZIP
Protein Properties Length: 206aa    MW: 23861.9 Da    PI: 10.0215
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100088950061genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.55.3e-1970124256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ +++k+q  +Lee F+ +++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  Ote100088950061|100088950061  70 RKKLRLSKDQSAVLEESFKDHNTLNPKQKMALAKRLGLRPRQVEVWFQNRRARTK 124
                                   788899***********************************************98 PP

2HD-ZIP_I/II130.56.6e-4270159191
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rlsk+q+++LEesF+ +++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+
  Ote100088950061|100088950061  70 RKKLRLSKDQSAVLEESFKDHNTLNPKQKMALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQ 150
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreel 91 
                                   kev+eLr +l
  Ote100088950061|100088950061 151 KEVQELR-AL 159
                                   ******9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.28166126IPR001356Homeobox domain
SMARTSM003892.4E-1668130IPR001356Homeobox domain
SuperFamilySSF466894.28E-1869134IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-1870124IPR009057Homeodomain-like
CDDcd000862.00E-1370127No hitNo description
PfamPF000462.4E-1670124IPR001356Homeobox domain
PRINTSPR000311.2E-597106IPR000047Helix-turn-helix motif
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5106122IPR000047Helix-turn-helix motif
SMARTSM003401.5E-26126169IPR003106Leucine zipper, homeobox-associated
PfamPF021831.3E-11126160IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MQIGVRERNR RELLAGDGGG GGGXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXRDCSRGI  60
SDEEDAENAR KKLRLSKDQS AVLEESFKDH NTLNPKQKMA LAKRLGLRPR QVEVWFQNRR  120
ARTKLKQTEV DCEFLKRCCE NLTEENRRLQ KEVQELRALK LSPQLYMQMT PPTTLTMCPS  180
CERVALPSSD PRPRSIPFNP WPCRPF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011081291.11e-91PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054664e-82HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLA0A022PSF07e-89A0A022PSF0_ERYGU; Uncharacterized protein
STRINGPOPTR_0003s07760.11e-85(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485